CDS

Accession Number TCMCG050C50618
gbkey CDS
Protein Id KAG6785838.1
Location complement(join(2844131..2844207,2844360..2844453,2845590..2845658,2845981..2846052))
Organism Populus tomentosa
locus_tag POTOM_007425

Protein

Length 103aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA613008, BioSample:SAMN14390005
db_source JAAWWB010000003.1
Definition hypothetical protein POTOM_007425 [Populus tomentosa]
Locus_tag POTOM_007425

EGGNOG-MAPPER Annotation

COG_category U
Description Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding
KEGG_TC 3.A.5.9
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko02044        [VIEW IN KEGG]
KEGG_ko ko:K03109        [VIEW IN KEGG]
EC -
KEGG_Pathway ko03060        [VIEW IN KEGG]
map03060        [VIEW IN KEGG]
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0005047        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005783        [VIEW IN EMBL-EBI]
GO:0005785        [VIEW IN EMBL-EBI]
GO:0005786        [VIEW IN EMBL-EBI]
GO:0005789        [VIEW IN EMBL-EBI]
GO:0005791        [VIEW IN EMBL-EBI]
GO:0006605        [VIEW IN EMBL-EBI]
GO:0006612        [VIEW IN EMBL-EBI]
GO:0006613        [VIEW IN EMBL-EBI]
GO:0006614        [VIEW IN EMBL-EBI]
GO:0006616        [VIEW IN EMBL-EBI]
GO:0006810        [VIEW IN EMBL-EBI]
GO:0006886        [VIEW IN EMBL-EBI]
GO:0008104        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0015031        [VIEW IN EMBL-EBI]
GO:0015833        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0030867        [VIEW IN EMBL-EBI]
GO:0031090        [VIEW IN EMBL-EBI]
GO:0031984        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0033036        [VIEW IN EMBL-EBI]
GO:0033365        [VIEW IN EMBL-EBI]
GO:0034613        [VIEW IN EMBL-EBI]
GO:0042175        [VIEW IN EMBL-EBI]
GO:0042886        [VIEW IN EMBL-EBI]
GO:0043021        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044425        [VIEW IN EMBL-EBI]
GO:0044432        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0044877        [VIEW IN EMBL-EBI]
GO:0045047        [VIEW IN EMBL-EBI]
GO:0045184        [VIEW IN EMBL-EBI]
GO:0046907        [VIEW IN EMBL-EBI]
GO:0048500        [VIEW IN EMBL-EBI]
GO:0051179        [VIEW IN EMBL-EBI]
GO:0051234        [VIEW IN EMBL-EBI]
GO:0051641        [VIEW IN EMBL-EBI]
GO:0051649        [VIEW IN EMBL-EBI]
GO:0055085        [VIEW IN EMBL-EBI]
GO:0065002        [VIEW IN EMBL-EBI]
GO:0070727        [VIEW IN EMBL-EBI]
GO:0070972        [VIEW IN EMBL-EBI]
GO:0071702        [VIEW IN EMBL-EBI]
GO:0071705        [VIEW IN EMBL-EBI]
GO:0071806        [VIEW IN EMBL-EBI]
GO:0072594        [VIEW IN EMBL-EBI]
GO:0072599        [VIEW IN EMBL-EBI]
GO:0072657        [VIEW IN EMBL-EBI]
GO:0090150        [VIEW IN EMBL-EBI]
GO:0098588        [VIEW IN EMBL-EBI]
GO:0098796        [VIEW IN EMBL-EBI]
GO:0098827        [VIEW IN EMBL-EBI]
GO:1990904        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGTTTACATGGCTTCATGGGACGAGTTCGTTGATCGATCCGTACAGTTGTTCCGTGCCGATCCTGATTCTACTCGGTATGTCATGAAGTACAGACACTGTGATGGCAAGTTGGTTCTCAAGGTCACTGACAACAAAGAGTGTCTTAAGTTCAAGACAGACCAGGCACAGGAAGCTAAGAAGATGGAGAAGCTAAACAACCTATTTTTTACTTTGATGTCTCGGGGCCCTGAAGCGGATCTGTCAGAAGTTACAGGGAAAGAACAGACAGAAGCACAGCCAGGGAAGAAAGGGAGGGGAAGGAAACAATAA
Protein:  
MVYMASWDEFVDRSVQLFRADPDSTRYVMKYRHCDGKLVLKVTDNKECLKFKTDQAQEAKKMEKLNNLFFTLMSRGPEADLSEVTGKEQTEAQPGKKGRGRKQ